cDNA, FLJ92011, Homo sapiens small nuclear ribonucleoprotein polypeptide F (SNRPF),mRNA (Small nuclear ribonucleoprotein polypeptide F, isoform CRA_a)

UniProt : B2R498, P62306, UniProt ID: B2R498_HUMAN, RUXF_HUMAN,

cDNA, FLJ92011, Homo sapiens small nuclear ribonucleoprotein polypeptide F (SNRPF),mRNA (Small nuclear ribonucleoprotein polypeptide F, isoform CRA_a)

Homo sapiens

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92011, Homo sapiens small nuclear ribonucleoprotein polypeptide F (SNRPF),mRNA (Small nuclear ribonucleoprotein polypeptide F, isoform CRA_a) contains a PF01423 domain.

cDNA, FLJ92011, Homo sapiens small nuclear ribonucleoprotein polypeptide F (SNRPF),mRNA (Small nuclear ribonucleoprotein polypeptide F, isoform CRA_a) is proteolytically cut by caspase-1 (C14.001) cleavage. EEED-GEMR.

cDNA, FLJ92011, Homo sapiens small nuclear ribonucleoprotein polypeptide F (SNRPF),mRNA (Small nuclear ribonucleoprotein polypeptide F, isoform CRA_a) is proteolytically cut by caspase-8 (C14.009) cleavage. EEED-GEMR.