CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5)

UniProt : P42830, Q6I9S7, UniProt ID: CXCL5_HUMAN, Q6I9S7_HUMAN,

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5)

Homo sapiens

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) contains a PF00048 domain.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AAVL-RELR.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VLRE-LRCV.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. MISN-LQVF.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAA-AVLR.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PAAA-VLRE.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. AAAV-LREL.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. MISN-LQVF.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQC-SKVE.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VVAS-LKNG.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. AAAV-LREL.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. IAAT-ELRC.

CXCL5 protein (Chemokine (C-X-C motif) ligand 5) (cDNA, FLJ92410, Homo sapiens chemokine (C-X-C motif) ligand 5 (CXCL5), mRNA) (Putative uncharacterized protein CXCL5) is proteolytically cut by matrix metallopeptidase-8 (M10.001) cleavage. IAAT-ELRC.