Core protein vp8

UniProt : P03295, Q76ZT5, UniProt ID: Q76ZT5_VACCV, VP8_VACCV,

Core protein vp8

Vaccinia virus (strain Western Reserve / WR)

MSLLLENLIEEDTIFFAGSISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELI
HNENITGAMFTTMYNIRNNLGLGDDKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKK
SGRRKNKNMVIFRQGSSPILCIFETRKKINIYKENMESASTEYTPIGDNKALISKYAGIN
ILNVYSPSTSIRLNAIYGFTNKNKLEKLSTNKELESYSSSPLQEPIRLNDFLGLLECVKK
NIPLTDIPTKD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Core protein vp8 contains a PF04498 domain.

Core protein vp8 is proteolytically cut by vaccinia virus I7L processing peptidase (C57.001) cleavage. VIAG-AKSK.