Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C)

UniProt : P11226, Q5SQS3, UniProt ID: MBL2_HUMAN, Q5SQS3_HUMAN,

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C)

Homo sapiens

MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) contains a PF00059 domain.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) contains a PF01391 domain.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-KLGP.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-QKGD.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPPG-KLGP.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPKG-QKGD.

Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect) (Mannose-binding lectin (Protein C) 2, soluble (Opsonic defect), isoform CRA_a) (Mannan-binding lectin) (Mannose-binding protein C) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. GLRG-LQGP.