Bos taurus FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAH CYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI ASN The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by (A9G.017) cleavage. DDDK-IVGG.
is proteolytically cut by (A9G.008) cleavage. DDDK-IVGG.
is proteolytically cut by aspergillopepsin I (A01.016) cleavage. DDDK-IVGG.
is proteolytically cut by candidapepsin SAP1 (A01.014) cleavage. DDDK-IVGG.
is proteolytically cut by rhizopuspepsin (A01.012) cleavage. DDDK-IVGG.