Myelin basic protein

UniProt : P02687, UniProt ID: MBP_BOVIN,

Myelin basic protein

Bos taurus

AAQKRPSQRSKYLASASTMDHARHGFLPRHRDTGILDSLGRFFGSDRGAPKRGSGKDGHH
AARTTHYGSLPQKAQGHRPQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQ
KPGFGYGGRASDYKSAHKGLKGHDAQGTLSKIFKLGGRDSRSGSPMARR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myelin basic protein contains a PF01669 domain.

Myelin basic protein is proteolytically cut by ADAM28 peptidase (M12.020) cleavage. GSLP-QKAQ.

Myelin basic protein is proteolytically cut by ADAM28 peptidase (M12.020) cleavage. GKGR-GLSL.

Myelin basic protein is proteolytically cut by ADAM28 peptidase (M12.020) cleavage. HHAA-RTTH.

Myelin basic protein is proteolytically cut by ADAM28 peptidase (M12.020) cleavage. LASA-STMD.