|
Homo sapiens MSLFDLFRGFFGFPGPRSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELP GPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHR FDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRT VVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
is proteolytically cut by HtrA stress response protease (S01.278) cleavage..
is proteolytically cut by caspase-3 (C14.003) cleavage. TLRD-SMLK.
is proteolytically cut by HtrA stress response protease (S01.278) cleavage..
is proteolytically cut by caspase-3 (C14.003) cleavage. TLRD-SMLK.
is proteolytically cut by caspase-3 (C14.003) cleavage. TLRD-SMLK.