Syntaxin-10

UniProt : O60499, UniProt ID: STX10_HUMAN,

Syntaxin-10

Homo sapiens

MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWD
LEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNR
EILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHM
SGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLL
LVLILLFSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Syntaxin-10 contains a PF05739 domain.

Syntaxin-10 contains a PF09177 domain.

Syntaxin-10 is proteolytically cut by caspase () cleavage. IMLD-AFAQ.

Syntaxin-10 is proteolytically cut by caspase () cleavage. DLLD-ASAV.