Autolysin

UniProt : P31178, UniProt ID: GLE_CHLRE,

Autolysin

Chlamydomonas reinhardtii

MSLATRRFGAAAALLVAACVLCTAPAWAQNETTGTGMVKTKSAFRWIRPPPARPPPFRRP
PPAQTPYVHKVEYTELQILCPQTIDSVTGYPMDDPRCNVPRATVAAGEEALTIRNEFELL
NGDVLNVTLEEVDTPENPSRRRLLSIIREEQRTGRVLLATSAELPTPTFRLKSLKSILKG
SQKEIYAGKPIDLRTIVYIMDFSSCKLSGWSAPATLTPEKVTSDMLRGASAPTNNLANYY
GACSYEKTLFNPDNFLVLGPVPVPCIGGVTPPPRPPRPPRPPPRAGSTISSLSRRNDTYD
DWWDLSKYCTASEQQAWERAAEAYAQAIVAQDPNSATGKKLQGILQWRERRRNIYILPPG
VKCSWSGYADVTCTSATCSAYVRGYSDTNAMQVIMHEAMHNYGLEHAGRGTLEYGDATDV
MGDFNKAGKGLLCPNAPNMYRIGWAKPINEPGVAPFQNATGAWGNLTAANFTTDPWIRGL
VIPAQGTRDDNMIVVNVGAQSTRDGAMKATGAQAYYFSYRIKNTTAGGYDSGLTLDFHKK
VLVHAYNGIQSERVFGFKSNLLDWGPNFQSRSNTWTSPFLAYNNGLGGGVRLVVQSTSDT
QAVVDICRISENGKELSCDDGIDNDCDGLQDNEDPDCQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Autolysin contains a PF05548 domain.

Autolysin is proteolytically cut by gametolysin (M11.001) cleavage. GSQK-EIYA.