ARF GTPase-activating protein GIT2

UniProt : Q9JLQ2, UniProt ID: GIT2_MOUSE,

ARF GTPase-activating protein GIT2

Mus musculus

MSKRLRSSDVCADCNGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTAWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCREDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGSTPLHVASKAGQI
LQAELLAEYGADPGTQDSSGKTPVDYARQGGHHELAERLIEIQYELTDRLAFYLCGRKPD
HKSGQHFLIPQRADSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLAT
QNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGSP
LSRSKDNVELILRTVSTQHSTESQDNDQPDYDSVASDEDTDVETRASKANRQKLQTLQSE
NSSLRRQATASACQVQTGSDHKDTASHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEA
SHPEESRTRLQPFPTHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESD
YDNTACDPEPDDTGSTRKGRQRSMLWQGDGLLPDTAEPHSVPSPTLPSTEDVIRKTEQIT
KNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDTVRTSLRLLTSSAYRLQ
SECRKALPGDSSLPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ARF GTPase-activating protein GIT2 contains a PF00023 domain.

ARF GTPase-activating protein GIT2 contains a PF00023 domain.

ARF GTPase-activating protein GIT2 contains a PF00023 domain.

ARF GTPase-activating protein GIT2 contains a PF01412 domain.

ARF GTPase-activating protein GIT2 contains a PF08518 domain.

ARF GTPase-activating protein GIT2 contains a PF08518 domain.

ARF GTPase-activating protein GIT2 is proteolytically cut by caspase-1 (C14.001) cleavage. DQPD-YDSV.