Serine/threonine-protein kinase N1

UniProt : P70268, UniProt ID: PKN1_MOUSE,

Serine/threonine-protein kinase N1

Mus musculus

MAGDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEGAENLR
RATTDLGRSLAPVELLLRGSARRLDLLHQQLQELHAHVVLPDPAAGSDATQSLAEGSPIC
SSTNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSSKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQALQAGELESQAAPDEAQGDPELGAVELRIEELRHHFRVEHAVAEGAKNVLR
LLSGAKAPDRKAVSEAQEKLTESNQKLGLLRESLERRLGELPADHPKGRLLREELTAASS
SAFSAILPGPFPATHYSTLSKPAPLTGTLEVRVVGCKNLPETIPWSPPPSVGASGTPESR
TPFLSRPARGLYSRSGSLSGRSSLRGEAENATEVSTVLKLDNTVVGQTAWKPCGPNAWDQ
SFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFR
NPIIERIPRLQRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPSAVATGTFSPNAS
PGAEIRHTGDISMEKLNLGADSDSSSQKSPPGLPSTSCSLSSPTHESTTSPELPSETQET
PGPGLCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDE
VESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPR
AVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFC
GTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPR
FLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLS
GRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFDFVAGGY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Serine/threonine-protein kinase N1 contains a PF00069 domain.

Serine/threonine-protein kinase N1 contains a PF00433 domain.

Serine/threonine-protein kinase N1 contains a PF02185 domain.

Serine/threonine-protein kinase N1 contains a PF02185 domain.

Serine/threonine-protein kinase N1 contains a PF02185 domain.

Serine/threonine-protein kinase N1 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AAPD-EAQG.