CG12244-PA (SD04985p) (MAP kinase kinase) (MAP kinase kinase 3) (Stress activated MAP kinase kinase 3)

UniProt : O62602, UniProt ID: O62602_DROME,

CG12244-PA (SD04985p) (MAP kinase kinase) (MAP kinase kinase 3) (Stress activated MAP kinase kinase 3)

Drosophila melanogaster

MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIV
DKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGM
IEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDAQPAQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CG12244-PA (SD04985p) (MAP kinase kinase) (MAP kinase kinase 3) (Stress activated MAP kinase kinase 3) contains a PF00069 domain.

CG12244-PA (SD04985p) (MAP kinase kinase) (MAP kinase kinase 3) (Stress activated MAP kinase kinase 3) is proteolytically cut by anthrax lethal factor (M34.001) cleavage..