F-box-like/WD repeat-containing protein TBL1XR1

UniProt : Q9BZK7, UniProt ID: TBL1R_HUMAN,

F-box-like/WD repeat-containing protein TBL1XR1

Homo sapiens

MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQ
QGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPV
SDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLL
ATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA
KQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPT
GNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSY
RGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF00400 domain.

F-box-like/WD repeat-containing protein TBL1XR1 contains a PF08513 domain.

F-box-like/WD repeat-containing protein TBL1XR1 is proteolytically cut by caspase () cleavage. MEVD-GDVE.