cDNA, FLJ79475, highly similar to Keratin, type II cytoskeletal 8 (Keratin 8, isoform CRA_c)

UniProt : B0AZN5, P05787, UniProt ID: B0AZN5_HUMAN, K2C8_HUMAN,

cDNA, FLJ79475, highly similar to Keratin, type II cytoskeletal 8 (Keratin 8, isoform CRA_c)

Homo sapiens

MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGM
GGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE
TKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYE
DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL
RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAAL
QRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA
GGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV
LPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ79475, highly similar to Keratin, type II cytoskeletal 8 (Keratin 8, isoform CRA_c) contains a PF00038 domain.

cDNA, FLJ79475, highly similar to Keratin, type II cytoskeletal 8 (Keratin 8, isoform CRA_c) is proteolytically cut by coxsackievirus-type picornain 2A (C03.022) cleavage. VSTS-GPRA.

cDNA, FLJ79475, highly similar to Keratin, type II cytoskeletal 8 (Keratin 8, isoform CRA_c) is proteolytically cut by rhinovirus picornain 2A (C03.021) cleavage. VSTS-GPRA.