Isoform 2 of C-X-C chemokine receptor type 4

UniProt : P61073, UniProt ID: P61073-2,

Isoform 2 of C-X-C chemokine receptor type 4

Homo sapiens

MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN
GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY
TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFAN
VSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK
ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCC
LNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of C-X-C chemokine receptor type 4 contains a PF00001 domain.

Isoform 2 of C-X-C chemokine receptor type 4 is proteolytically cut by neutrophil elastase (S01.131) cleavage..

Isoform 2 of C-X-C chemokine receptor type 4 is proteolytically cut by cathepsin G (S01.133) cleavage..