Uncharacterized membrane protein YFL051C

UniProt : P43552, UniProt ID: YFF1_YEAST,

Uncharacterized membrane protein YFL051C

Saccharomyces cerevisiae

MSIPHSVFSALLVFVALATTTLASTEACLPTNKREDGMNINFYEYTIGDQTTYLEPEYMG
YEYSNTKKLGSVSGQTNLSIYYSPPCESTPTCVTYAVLKRDEDGYDPCGPLYETKKRDTE
YCDPNTAYWSSDLFGFYTTPTNVTVEMTGYLIWSMGNRRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Uncharacterized membrane protein YFL051C is proteolytically cut by kexin (S08.070) cleavage. TNKR-EDGM.

Uncharacterized membrane protein YFL051C is proteolytically cut by kexin (S08.070) cleavage. VLKR-DEDG.

Uncharacterized membrane protein YFL051C is proteolytically cut by kexin (S08.070) cleavage. TKKR-DTEY.