cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a)

UniProt : B2RD59, P06733, UniProt ID: B2RD59_HUMAN, ENOA_HUMAN,

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a)

Homo sapiens

MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKV
VIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDD
WGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLA
QANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK
AKFAGRNFRNPLAK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) contains a PF00113 domain.

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) contains a PF03952 domain.

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEVD-LFTS.

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by calpain-2 (C02.002) cleavage..

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VEVD-LFTS.

cDNA, FLJ96469, Homo sapiens enolase 1, (alpha) (ENO1), mRNA (Enolase 1, (Alpha), isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage..