Neurotrophin-3

UniProt : P20783, UniProt ID: NTF3_HUMAN,

Neurotrophin-3

Homo sapiens

MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK
TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI
RIDTSCVCALSRKIGRT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Neurotrophin-3 contains a PF00243 domain.

Neurotrophin-3 is proteolytically cut by furin (S08.071) cleavage. RRKR-YAEH.

Neurotrophin-3 is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RRKR-YAEH.