Neurotrophin-3
|
UniProt : P20783, UniProt ID: NTF3_HUMAN, Neurotrophin-3 Homo sapiens MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ STLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM EDYVGSPVVANRTSRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIK TGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWI RIDTSCVCALSRKIGRT The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Neurotrophin-3 contains a PF00243 domain.
Neurotrophin-3 is proteolytically cut by furin (S08.071) cleavage. RRKR-YAEH.
Neurotrophin-3 is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. RRKR-YAEH.