Putative uncharacterized protein

UniProt : P19221, Q3TJ94, UniProt ID: Q3TJ94_MOUSE, THRB_MOUSE,

Putative uncharacterized protein

Mus musculus

MSHVRGLGLPGCLALAALVSLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGVNYLGT
VNVTHTGIQCQLWRSRYPHKPEINSTTHPGADLKENFCRNPDSSTTGPWCYTTDPTVRRE
ECSVPVCGQEGRTTVVMTPRSGGSKDNLSPPLGQCLTERGRLYQGNLAVTTLGSPCLPWN
SLPAKTLSKYQDFDPEVKLVENFCRNPDWDEEGAWCYVAGQPGDFEYCNLNYCEEAVGEE
NYDVDESIAGRTTDAEFHTFFNEKTFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDGR
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLL
VRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCL
PDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR
ITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFY
THVFRLKRWIQKVIDQFG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00051 domain.

Putative uncharacterized protein contains a PF00051 domain.

Putative uncharacterized protein contains a PF00089 domain.

Putative uncharacterized protein contains a PF00594 domain.

Putative uncharacterized protein is proteolytically cut by thrombin (S01.217) cleavage. MTPR-SGGS.

Putative uncharacterized protein is proteolytically cut by coagulation factor Xa (S01.216) cleavage. FNEK-TFGL.

Putative uncharacterized protein is proteolytically cut by coagulation factor Xa (S01.216) cleavage. IDGR-IVEG.