Isoform 6 of Merlin

UniProt : P35240, UniProt ID: P35240-6,

Isoform 6 of Merlin

Homo sapiens

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVLDHDVSKEEPVTFHFLAKFYP
ENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGF
LAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
AIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDV
FKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLARE
KQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKA
AEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAR
EAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIE
KEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQA
QGRRPICI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 6 of Merlin contains a PF00769 domain.

Isoform 6 of Merlin contains a PF00373 domain.

Isoform 6 of Merlin is proteolytically cut by calpain-1 (C02.001) cleavage. LILQ-LCIG.

Isoform 6 of Merlin is proteolytically cut by calpain-2 (C02.002) cleavage. RVNK-LILQ.

Isoform 6 of Merlin is proteolytically cut by calpain-2 (C02.002) cleavage. LILQ-LCIG.

Isoform 6 of Merlin is proteolytically cut by calpain-1 (C02.001) cleavage. LILQ-LCIG.

Isoform 6 of Merlin is proteolytically cut by calpain-2 (C02.002) cleavage. RVNK-LILQ.

Isoform 6 of Merlin is proteolytically cut by calpain-2 (C02.002) cleavage. LILQ-LCIG.

Isoform 6 of Merlin is proteolytically cut by calpain-1 (C02.001) cleavage. RVNK-LILQ.