cDNA FLJ11694 fis, clone HEMBA1005009, highly similar to Actin-like protein 6A (Actin-like 6A, isoform CRA_c)

UniProt : B3KMN1, O96019, UniProt ID: ACL6A_HUMAN, B3KMN1_HUMAN,

cDNA FLJ11694 fis, clone HEMBA1005009, highly similar to Actin-like protein 6A (Actin-like 6A, isoform CRA_c)

Homo sapiens

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ11694 fis, clone HEMBA1005009, highly similar to Actin-like protein 6A (Actin-like 6A, isoform CRA_c) contains a PF00022 domain.

cDNA FLJ11694 fis, clone HEMBA1005009, highly similar to Actin-like protein 6A (Actin-like 6A, isoform CRA_c) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IDGD-KGKQ.