cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a)

UniProt : B2R502, Q13541, UniProt ID: 4EBP1_HUMAN, B2R502_HUMAN,

cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a)

Homo sapiens

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a) contains a PF05456 domain.

cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. VLGD-GVQL.

cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. VLGD-GVQL.

cDNA, FLJ92286, Homo sapiens eukaryotic translation initiation factor 4E bindingprotein 1 (EIF4EBP1), mRNA (Eukaryotic translation initiation factor 4E binding protein 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. VLGD-GVQL.