Eukaryotic translation initiation factor 4A, isoform 2 (Eukaryotic translation initiation factor 4A, isoform 2, isoform CRA_a)

UniProt : Q14240, Q53XJ6, UniProt ID: IF4A2_HUMAN, Q53XJ6_HUMAN,

Eukaryotic translation initiation factor 4A, isoform 2 (Eukaryotic translation initiation factor 4A, isoform 2, isoform CRA_a)

Homo sapiens

MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQ
QRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKV
ILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMF
VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKE
ELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHR
IGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Eukaryotic translation initiation factor 4A, isoform 2 (Eukaryotic translation initiation factor 4A, isoform 2, isoform CRA_a) contains a PF00270 domain.

Eukaryotic translation initiation factor 4A, isoform 2 (Eukaryotic translation initiation factor 4A, isoform 2, isoform CRA_a) contains a PF00271 domain.

Eukaryotic translation initiation factor 4A, isoform 2 (Eukaryotic translation initiation factor 4A, isoform 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. MDPD-GVIE.