Isoform ASF-3 of Splicing factor, arginine/serine-rich 1

UniProt : Q07955, UniProt ID: Q07955-3,

Isoform ASF-3 of Splicing factor, arginine/serine-rich 1

Homo sapiens

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEVGYTRILFFDQNWIQWS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform ASF-3 of Splicing factor, arginine/serine-rich 1 contains a PF00076 domain.

Isoform ASF-3 of Splicing factor, arginine/serine-rich 1 contains a PF00076 domain.

Isoform ASF-3 of Splicing factor, arginine/serine-rich 1 is proteolytically cut by caspase-3 (C14.003) cleavage..