cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a)

UniProt : A8KA78, P11387, UniProt ID: A8KA78_HUMAN, TOP1_HUMAN,

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a)

Homo sapiens

MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) contains a PF02919 domain.

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) contains a PF01028 domain.

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage. PEDD-GYFV.

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) is proteolytically cut by caspase-6 (C14.005) cleavage. EEED-GKLK.

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DDAD-YKPK.

cDNA FLJ77890, highly similar to Homo sapiens type I DNA topoisomerase gene (Topoisomerase (DNA) I, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEAD-FRLN.