cDNA FLJ78438, highly similar to Homo sapiens cleavage stimulation factor, 3' pre-RNA, subunit 3,77kDa (CSTF3), mRNA (Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, isoform CRA_a)

UniProt : A8K471, Q12996, UniProt ID: A8K471_HUMAN, CSTF3_HUMAN,

cDNA FLJ78438, highly similar to Homo sapiens cleavage stimulation factor, 3' pre-RNA, subunit 3,77kDa (CSTF3), mRNA (Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, isoform CRA_a)

Homo sapiens

MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQ
FPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE
KMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPM
INIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQ
NTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQY
LEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVH
SIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEY
YCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEK
SGEIWARFLAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASE
LKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPP
GLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNTVEEAVRIIT
GGAPELAVEGNGPVESNAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKRIR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ78438, highly similar to Homo sapiens cleavage stimulation factor, 3' pre-RNA, subunit 3,77kDa (CSTF3), mRNA (Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, isoform CRA_a) contains a PF05843 domain.

cDNA FLJ78438, highly similar to Homo sapiens cleavage stimulation factor, 3' pre-RNA, subunit 3,77kDa (CSTF3), mRNA (Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, isoform CRA_a) is proteolytically cut by caspase () cleavage. DEVD-RKPE.