Interleukin-1 family member 7

UniProt : Q9NZH6, UniProt ID: IL1F7_HUMAN,

Interleukin-1 family member 7

Homo sapiens

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKF
SIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTS
CNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interleukin-1 family member 7 contains a PF00340 domain.

Interleukin-1 family member 7 is proteolytically cut by caspase-1 (C14.001) cleavage. WEKD-EPQC.

Interleukin-1 family member 7 is proteolytically cut by caspase-4 (C14.007) cleavage. WEKD-EPQC.