Keratin, type I cytoskeletal 18

UniProt : P05783, UniProt ID: K1C18_HUMAN,

Keratin, type I cytoskeletal 18

Homo sapiens

MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGS
GGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKG
PQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVEN
DIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAP
KSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQA
QEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVS
ETNDTKVLRH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Keratin, type I cytoskeletal 18 contains a PF00038 domain.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-7 (C14.004) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-6 (C14.005) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. DALD-SSNS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-7 (C14.004) cleavage. DALD-SSNS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-7 (C14.004) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-6 (C14.005) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. DALD-SSNS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-7 (C14.004) cleavage. DALD-SSNS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. VEVD-APKS.

Keratin, type I cytoskeletal 18 is proteolytically cut by caspase-3 (C14.003) cleavage. DALD-SSNS.