Myosin light chain 3, skeletal muscle isoform
|
Myosin light chain 3, skeletal muscle isoform Rattus norvegicus MSFSADQIAEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMN AKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK EEEVEALLAGQEDSNGCINYEAFVKHIMSV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Myosin light chain 3, skeletal muscle isoform contains a PF00036 domain.
Myosin light chain 3, skeletal muscle isoform contains a PF00036 domain.
Myosin light chain 3, skeletal muscle isoform is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. CINY-EAFV.