cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA

UniProt : A8KA34, Q8N573, UniProt ID: A8KA34_HUMAN, OXR1_HUMAN,

cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA

Homo sapiens

MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPVSPLSPTSSEAEFDKTTNPDVHPTEATPSSTFTGIRPARVVSSTSEEEEA
FTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKNDPLVQENGCEEYGIMCPMEEVM
SAAMYKEILDSKIKESLPIDIDQLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSASTAPR
STEESLSEDVFTESELSPIREELVSSDELRQDKSSGASSESVQTVNQAEVESLTVKSEST
GTPGHLRSDTEHSTNEVGTLCHKTDLNNLEMAIKEDQIADNFQGISGPKEDSTSIKGNSD
QDSFLHENSLHQEESQKENMPCGETAEFKQKQSVNKGKQGKEQNQDSQTEAEELRKLWKT
HTMQQTKQQRENIQQVSQKEAKHKITSADGHIESSALLKEKQRHRLHKFLCLRVGKPMRK
TFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDTGEYTREPGFI
VVKKIEESETIEDSSNQAAAREWEITTREDINSKQVATVKADLESESFRPNLSDPSELLL
PDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFG
ALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALW
LDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA contains a PF01476 domain.

cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA contains a PF02893 domain.

cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA contains a PF07534 domain.

cDNA FLJ76975, highly similar to Homo sapiens oxidation resistance 1 (OXR1), mRNA is proteolytically cut by caspase () cleavage. TSAD-GHIE.