STE20-like kinase (Yeast)

UniProt : A2RRK4, O54988, UniProt ID: A2RRK4_MOUSE, SLK_MOUSE,

STE20-like kinase (Yeast)

Mus musculus

MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEEFWEIIGELGDGAFGKVYKAQNKETNVLA
AAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM
LELERPLTESQIQVVCKQTLEALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKN
TRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNP
MRVLLKIAKSEPPTLAQPSKWSSNFKDFLRKCLEKNVDARWTTSQLLQHPFVTVDSNKPV
RELIAEAKAEVTEEVEDGKEEDEEEEAENALPIPANKRASSDLSIASSEEDKLSQNACIL
ESVSERTEQSTSEDKFSNKILNEKPTTDGPEKAVDEHASDVNLETGAELNDQTVGIHENG
REKKRPKLENLPDTQDQQTVDVNSVSEENENNRVTLETNTDCLKPEEDRNKENQETLESK
LIQSEEINDTHIQTMDLVSQETGEKEADFQAVDNEVGLTKEETQEKLGKDGTAQKVITSD
RSSEVGTDEALDDTQKAAELSKAAQSGEGDEALAPTQTLAEKPTEGPEAGGAEEEPPGGE
RVEDKQPEQQPAVCEAEGQLTSTSETTRATLEQPETDEVEQVSESNSIEELERLVVTGAE
ARALGSEGEAAATEVDLERKENAQKVPVKAESQAPAASQPSEPHPVLIPSININSETTEN
KEEMGALPKPETILPPEPEHEKGNDTDSGTGSTVENSSGDLNLSISSFLSKAKDSGSVSL
QETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRLLQKEEQ
RAQQQLNGKLQQQREQIFRRFEQEMLSKKRQYDQEIENLEKQQKQTIERLEQEHTNRLRD
EAKRIKGEQEKELSKFQNVLKNRKKEVMNEVEKAPRELRRELTKRRKEELAQSQHAQEQE
FVQKQQQELDGSLKKIIQQQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKHQL
LKQQLKDQYFMQRHQLLKRHEKETEQMQRYNQRLIEELKNRQTQERARLPKIQRSEAKTR
MAMFKKSLRINSTATPDQDREKIKQFAAQEEKRQKNERMAQHQKHESQMRDLQLQCEANV
RELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEV
FFKMTGESECLNPSAQSRISKFYPIPTLHSTGS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

STE20-like kinase (Yeast) contains a PF00069 domain.

STE20-like kinase (Yeast) is proteolytically cut by caspase-1 (C14.001) cleavage. LGSE-GEAA.