Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a)

UniProt : A4D2F4, P08833, UniProt ID: A4D2F4_HUMAN, IBP1_HUMAN,

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a)

Homo sapiens

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQIYFNVQN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) contains a PF00086 domain.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) contains a PF00219 domain.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. KALH-VTNI.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-11 (M10.007) cleavage. KALH-VTNI.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. KALH-VTNI.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KALH-VTNI.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage..

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by plasmin (S01.233) cleavage..

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. TNIK-KWKE.

Insulin-like growth factor binding protein 1 (Insulin-like growth factor binding protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. TNIK-KWKE.