Coagulation factor XIII, A1 polypeptide

UniProt : Q9BX29, UniProt ID: Q9BX29_HUMAN,

Coagulation factor XIII, A1 polypeptide

Homo sapiens

MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD
TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL
YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD
TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF
RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET
LRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG
ELDVQIQRRPSM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Coagulation factor XIII, A1 polypeptide contains a PF00868 domain.

Coagulation factor XIII, A1 polypeptide contains a PF00927 domain.

Coagulation factor XIII, A1 polypeptide contains a PF00927 domain.

Coagulation factor XIII, A1 polypeptide contains a PF01841 domain.

Coagulation factor XIII, A1 polypeptide is proteolytically cut by thrombin (S01.217) cleavage. VVPR-GVNL.

Coagulation factor XIII, A1 polypeptide is proteolytically cut by thrombin (S01.217) cleavage. VVPR-GVNL.

Coagulation factor XIII, A1 polypeptide is proteolytically cut by thrombin (S01.217) cleavage. VVPR-GVNL.