Isoform 8 of Pro-neuregulin-1, membrane-bound isoform
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform Homo sapiens MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLP E The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF00008 domain.
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF02158 domain.
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF00047 domain.
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..
Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..