Isoform 8 of Pro-neuregulin-1, membrane-bound isoform

UniProt : Q02297, UniProt ID: Q02297-8,

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform

Homo sapiens

MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSLP
E

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF00008 domain.

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF02158 domain.

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform contains a PF00047 domain.

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Isoform 8 of Pro-neuregulin-1, membrane-bound isoform is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..