Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b)

UniProt : B5BUA2, Q08209, UniProt ID: B5BUA2_HUMAN, PP2BA_HUMAN,

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b)

Homo sapiens

MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b) contains a PF00149 domain.

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage..

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage..

Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (Protein phosphatase 3 (Formerly 2B), catalytic subunit, alpha isoform (Calcineurin A alpha), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. SINK-ALTS.