CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1)

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1)

Homo sapiens

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) contains a PF02234 domain.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by caspase-3 (C14.003) cleavage. DHVD-LSLS.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by caspase-3 (C14.003) cleavage. DHVD-LSLS.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by caspase-3 (C14.003) cleavage. SMTD-FYHS.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by caspase-3 (C14.003) cleavage. DHVD-LSLS.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by myeloblastin (S01.134) cleavage. YLPT-GPRR.

CDKN1A protein (Cyclin-dependent kinase inhibitor 1A (P21, Cip1), isoform CRA_a) (Cyclin-dependent kinase inhibitor 1A) (P21, Cip1) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LEGD-FAWE .