cDNA FLJ39024 fis, clone NT2RP7004428, highly similar to Cleavage and polyadenylation specificity factor 7

UniProt : B3KU04, Q8N684, UniProt ID: B3KU04_HUMAN, CPSF7_HUMAN,

cDNA FLJ39024 fis, clone NT2RP7004428, highly similar to Cleavage and polyadenylation specificity factor 7

Homo sapiens

MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ39024 fis, clone NT2RP7004428, highly similar to Cleavage and polyadenylation specificity factor 7 contains a PF00076 domain.

cDNA FLJ39024 fis, clone NT2RP7004428, highly similar to Cleavage and polyadenylation specificity factor 7 is proteolytically cut by caspase-3 (C14.003) cleavage. DQID-LYDD.