Heterogeneous nuclear ribonucleoprotein D0

UniProt : Q14103, UniProt ID: HNRPD_HUMAN,

Heterogeneous nuclear ribonucleoprotein D0

Homo sapiens

MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGS
AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKF
GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Heterogeneous nuclear ribonucleoprotein D0 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoprotein D0 contains a PF00076 domain.

Heterogeneous nuclear ribonucleoprotein D0 is proteolytically cut by caspase () cleavage. AKID-ASKN.