cDNA, FLJ95461, highly similar to Homo sapiens transforming, acidic coiled-coil containing protein 1 (TACC1), mRNA (Transforming, acidic coiled-coil containing protein 1, isoform CRA_a)

UniProt : B2RBD9, O75410, UniProt ID: B2RBD9_HUMAN, TACC1_HUMAN,

cDNA, FLJ95461, highly similar to Homo sapiens transforming, acidic coiled-coil containing protein 1 (TACC1), mRNA (Transforming, acidic coiled-coil containing protein 1, isoform CRA_a)

Homo sapiens

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGN
FETPEAETPIRSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSEN
EVPQQAIDSHSVKNFREEPEHDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSG
KALPSSPPDALQDEAMTEGSMGVTLEASAEADLKAGNSCPELVPSRRSKLRKPKPVPLRK
KAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLGDARFQKSPPDLKETPGTLSS
DTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLTPKIQKDGISK
SAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPD
NFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALD
ACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVP
VSTINHAFSSSEAGIEKETCQKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSE
SDKTAVLTLIREEIITKEIEANEWKKKYEETRQEVLEMRKIVAEYEKTIAQMIEDEQRTS
MTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKGVLEGFKKNEEALKKCAQDYL
ARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQMKVESLERAL
QQKNQEIEELTKICDELIAKLGKTD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95461, highly similar to Homo sapiens transforming, acidic coiled-coil containing protein 1 (TACC1), mRNA (Transforming, acidic coiled-coil containing protein 1, isoform CRA_a) contains a PF05010 domain.

cDNA, FLJ95461, highly similar to Homo sapiens transforming, acidic coiled-coil containing protein 1 (TACC1), mRNA (Transforming, acidic coiled-coil containing protein 1, isoform CRA_a) is proteolytically cut by caspase () cleavage. SNRD-GHAT.