cDNA, FLJ95739, highly similar to Homo sapiens cold shock domain protein A (CSDA), mRNA (Cold shock domain protein A, isoform CRA_a)

UniProt : B2RBW6, P16989, UniProt ID: B2RBW6_HUMAN, DBPA_HUMAN,

cDNA, FLJ95739, highly similar to Homo sapiens cold shock domain protein A (CSDA), mRNA (Cold shock domain protein A, isoform CRA_a)

Homo sapiens

MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDA
APAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQ
TAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRG
YYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPY
HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR
PAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTE
NPAPPTQQSSAE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95739, highly similar to Homo sapiens cold shock domain protein A (CSDA), mRNA (Cold shock domain protein A, isoform CRA_a) contains a PF00313 domain.

cDNA, FLJ95739, highly similar to Homo sapiens cold shock domain protein A (CSDA), mRNA (Cold shock domain protein A, isoform CRA_a) is proteolytically cut by caspase () cleavage. EMKD-GVPE.

cDNA, FLJ95739, highly similar to Homo sapiens cold shock domain protein A (CSDA), mRNA (Cold shock domain protein A, isoform CRA_a) is proteolytically cut by caspase () cleavage. TGPD-GVPV.