V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a)

UniProt : B0LPE5, P31749, UniProt ID: AKT1_HUMAN, B0LPE5_HUMAN,

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a)

Homo sapiens

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a) contains a PF00433 domain.

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a) contains a PF00169 domain.

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a) contains a PF00069 domain.

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. ECVD-SERR.

V-akt murine thymoma viral oncogene homolog 1 (V-akt murine thymoma viral oncogene homolog 1, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage..