Ubiquitin-like protein SMT3
UniProt : Q12306, UniProt ID: SMT3_YEAST, Ubiquitin-like protein SMT3 Saccharomyces cerevisiae MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Ubiquitin-like protein SMT3 contains a PF00240 domain.
Ubiquitin-like protein SMT3 is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. QIGG-ATY-.