Ubiquitin-like protein SMT3

UniProt : Q12306, UniProt ID: SMT3_YEAST,

Ubiquitin-like protein SMT3

Saccharomyces cerevisiae

MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Ubiquitin-like protein SMT3 contains a PF00240 domain.

Ubiquitin-like protein SMT3 is proteolytically cut by Ulp1 peptidase (C48.001) cleavage. QIGG-ATY-.