Novel protein (5830434P21Rik)

UniProt : A2AN31, Q7TPM1, UniProt ID: A2AN31_MOUSE, K0515_MOUSE,

Novel protein (5830434P21Rik)

Mus musculus

MSDRLGQITQGKDGKSKYSTLSLFDKYKGRSVGAVRSSVIPRHGLQSLGKVATARRMPPP
ANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSVTASQPPESQPQPGLQKSVS
NLQKPTQSISQENTNSVPGGPKSWAQLSGKPVGHEGGLRGSSRLLSFSPEEFPTLKAAGG
QDKAGKEKGALDLSYGPGPSLRPQNVTSWREGGGRNIISAASLSASPTELGSRNASGADG
APSLACTSDSKEPSLRPAQPSRRGASQFMGHGYQPPTYHDMLPAFMCSPQSSENQTTVER
SSFPLPQLRLEPRVPFRQFQMNDQDGKERPGVARPVRPLRQLVERAPRPTIINAENLKGL
DDLDTDADDGWAGLHEEVDYSEKLKFSDDEDEEDVVKDGRSKWNNWDPRRQRALSLSSAD
STDAKRTQEEGKDWSGTAGGSRVIRKVPEPQPPSRKLHSWASGPDYQKPTMGSMFRQHSA
EDKEDKPPPRQKFIQSEMSEAVERARKRREEEERRAREERLAACAAKLKQLDQKCRQAQK
ANETPKPVEKEVPRSPGIEKVSPPENGPVVRKGSPEFPVQEAPTMFLEETPATSPTVAQS
NSSSSSSSSSSIEEEVRESGSPAQEFSKYQKSLPPRFQRQQQQQQQQQQQQQQQEQLYKM
QHWQPVYPPPSHPQRTFYPHHPQMLGFDPRWMMMPSYMDPRITPTRTPVDFYPSALHPSG
LMKPMMPQESLSGTGCRSEDQNCVPSLQERKVTALDPAPVWSPEGYMALQNKGYSLPHPK
SADTLAMGMHVRSPDEALPGGLGSHSPYALERTTHASSDGPETPSKKSEREVSLPTQRAS
EQEEARKQFDLGYGNALIDNCASSPGEENEASSVVGEGFIEVLTKKQRRLLEEERRKKEQ
AAQVPVKGRGLSSRIPPRFAKKQNGLCLEQDVTVPGSSLGTEIWENSSQALPVQGAASDS
WRTAVTAFSSTEPGTSEQGFKSSQGDSGVDLSAESRESSATSSQRSSPYGTLKPEEISGP
GLAESKADSHKDQAQKQAEHKDSEQGSAQSKEHRPGPIGNERSLKNRKGSEGAERLPGAV
VPPVNGVEIHVDSVLPVPPIEFGVSPKDSDFSLPPGSVSGPVGNPVAKLQDVLASNAGLT
QSIPILRRDHHMQRAIGLSPMSFPTADLTLKMESARKAWENSPSLPEQSSPGGAGSGIQP
PSSVGASNGVNYSSFGGVSMPPMPVASVAPSASIPGSHLPPLYLDGHVFASQPRLVPQTI
PQQQSYQQAATAQQIPISLHTSLQAQAQLGLRGGLPVSQSQEIFSSLQPFRSQVYMHPSL
SPPSTMILSGGTALKPPYSAFPGIQPLEMVKPQSGSPYQPMSGNQALVYEGQLGQAAGLG
TSQMLDSQLPQLTMPLPRYGSGQQPLILPQSIQLPPGQSLSVGAPRRVPPPGSQPPVLNT
SRESAPMELKGFHFADSKQNVPTGGSAPSPQAYRQSEWMKNPAWEP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Novel protein (5830434P21Rik) contains a PF07001 domain.

Novel protein (5830434P21Rik) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VVGE-GFIE.