cDNA, FLJ92103, Homo sapiens ubiquitin-like 1 (sentrin) (UBL1), mRNA (SMT3 suppressor of mif two 3 homolog 1 (Yeast), isoform CRA_a)

UniProt : B2R4I5, P63165, UniProt ID: B2R4I5_HUMAN, SUMO1_HUMAN,

cDNA, FLJ92103, Homo sapiens ubiquitin-like 1 (sentrin) (UBL1), mRNA (SMT3 suppressor of mif two 3 homolog 1 (Yeast), isoform CRA_a)

Homo sapiens

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92103, Homo sapiens ubiquitin-like 1 (sentrin) (UBL1), mRNA (SMT3 suppressor of mif two 3 homolog 1 (Yeast), isoform CRA_a) contains a PF00240 domain.

cDNA, FLJ92103, Homo sapiens ubiquitin-like 1 (sentrin) (UBL1), mRNA (SMT3 suppressor of mif two 3 homolog 1 (Yeast), isoform CRA_a) is proteolytically cut by SENP1 peptidase (C48.002) cleavage. QTGG-HSTV.