cDNA FLJ76321, highly similar to Homo sapiens MYC associated factor X (MAX), transcript variant 1, mRNA (MYC associated factor X, isoform CRA_g)
|
UniProt : A8K824, P61244, UniProt ID: A8K824_HUMAN, MAX_HUMAN, cDNA FLJ76321, highly similar to Homo sapiens MYC associated factor X (MAX), transcript variant 1, mRNA (MYC associated factor X, isoform CRA_g) Homo sapiens MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ76321, highly similar to Homo sapiens MYC associated factor X (MAX), transcript variant 1, mRNA (MYC associated factor X, isoform CRA_g) contains a PF00010 domain.
cDNA FLJ76321, highly similar to Homo sapiens MYC associated factor X (MAX), transcript variant 1, mRNA (MYC associated factor X, isoform CRA_g) is proteolytically cut by caspase-5 (C14.008) cleavage. IEVE-SDEE.
cDNA FLJ76321, highly similar to Homo sapiens MYC associated factor X (MAX), transcript variant 1, mRNA (MYC associated factor X, isoform CRA_g) is proteolytically cut by caspase-7 (C14.004) cleavage. SAFD-GGSD.