Splicing factor U2AF 65 kDa subunit

UniProt : P26368, UniProt ID: U2AF2_HUMAN,

Splicing factor U2AF 65 kDa subunit

Homo sapiens

MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQV
PGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRP
VDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Splicing factor U2AF 65 kDa subunit contains a PF00076 domain.

Splicing factor U2AF 65 kDa subunit contains a PF00076 domain.

Splicing factor U2AF 65 kDa subunit contains a PF00076 domain.

Splicing factor U2AF 65 kDa subunit is proteolytically cut by caspase-3 (C14.003) cleavage. MTPD-GLAV.

Splicing factor U2AF 65 kDa subunit is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PDGL-AVTP.

Splicing factor U2AF 65 kDa subunit is proteolytically cut by granzyme B, human-type (S01.010) cleavage. MTPD-GLAV.