Prothymosin alpha

UniProt : P26350, Q0VGU2, UniProt ID: PTMA_MOUSE, Q0VGU2_MOUSE,

Prothymosin alpha

Mus musculus

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTKKQKTEEDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prothymosin alpha contains a PF03247 domain.

Prothymosin alpha is proteolytically cut by caspase-1 (C14.001) cleavage. EEEE-EEGD.