Prothymosin alpha

UniProt : P06454, UniProt ID: PTMA_HUMAN,

Prothymosin alpha

Homo sapiens

MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEG
GEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prothymosin alpha contains a PF03247 domain.

Prothymosin alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. EEED-GDED.

Prothymosin alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. AAVD-TSSE.

Prothymosin alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. VDTS-SEIT.