Isoform 2 of Syntaxin-5

UniProt : Q08851, UniProt ID: Q08851-2,

Isoform 2 of Syntaxin-5

Rattus norvegicus

MSCRDRTQEFLSACKSLQSRQNGIQTNKPALHATRQCSEFTLMARRIGKDLSNTFAKLEK
LTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNT
IVVSLQSKLASMSNDFKSVLEVRTENLKQQRNRREQFSRAPVSALPLAPNNLGGGPIVLG
GESRASRDVAIDMMDPRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMV
KEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFL
A

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Syntaxin-5 contains a PF00804 domain.

Isoform 2 of Syntaxin-5 contains a PF05739 domain.

Isoform 2 of Syntaxin-5 is proteolytically cut by caspase-3 (C14.003) cleavage. DEQD-SYIQ.

Isoform 2 of Syntaxin-5 is proteolytically cut by caspase-7 (C14.004) cleavage..