cDNA FLJ45669 fis, clone CTONG3003669, highly similar to YTH domain protein 3 (YTH domain family, member 3, isoform CRA_b)

UniProt : B3KXL4, Q7Z739, UniProt ID: B3KXL4_HUMAN, YTHD3_HUMAN,

cDNA FLJ45669 fis, clone CTONG3003669, highly similar to YTH domain protein 3 (YTH domain family, member 3, isoform CRA_b)

Homo sapiens

MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLG
QHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSK
VPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSVPPVSSAAPKPTSWAA
IARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTI
IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAPRNR
GAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMK
SVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPL
EKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ45669 fis, clone CTONG3003669, highly similar to YTH domain protein 3 (YTH domain family, member 3, isoform CRA_b) contains a PF04146 domain.

cDNA FLJ45669 fis, clone CTONG3003669, highly similar to YTH domain protein 3 (YTH domain family, member 3, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. AITD-GQAG.